PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G062800.1.p
Common NameSb01g005700, SORBIDRAFT_01g005700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 181aa    MW: 19091.7 Da    PI: 8.4092
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G062800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.51.6e-36201201101
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk +rrkC +dCvlapyfpa++p+++a+v+++FGasnv ++l++lp +er +a++++++eA+ r++dPvyG++g++ +lq +++ 
  Sobic.001G062800.1.p  20 RCAACKNQRRKCGHDCVLAPYFPASDPQRYACVQRVFGASNVARMLQNLPVHERARAADTMAMEARRRVQDPVYGCAGIVGRLQGEIRA 108
                           6**************************************************************************************** PP

                DUF260  90 lkaelallkeel 101
                           ++ ela++++++
  Sobic.001G062800.1.p 109 AQCELARTQAQI 120
                           *******99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.53719120IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3520117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSTSATNTEA AAASSSPGKR CAACKNQRRK CGHDCVLAPY FPASDPQRYA CVQRVFGASN  60
VARMLQNLPV HERARAADTM AMEARRRVQD PVYGCAGIVG RLQGEIRAAQ CELARTQAQI  120
AVHAAAAAVR ARPAPAVDAL AAGQHAPAAP LQQQDDDAAF QGLDALLIDD CRWDGLARLL  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466327.11e-127hypothetical protein SORBIDRAFT_01g005700
SwissprotP594671e-41LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594681e-41LBD24_ARATH; LOB domain-containing protein 24
TrEMBLC5WY441e-127C5WY44_SORBI; Putative uncharacterized protein Sb01g005700
STRINGSb01g005700.11e-126(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-36LOB domain-containing protein 24